PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00008402001
Common NameGSBRNA2T00008402001, LOC106397533
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 260aa    MW: 28970.4 Da    PI: 9.2706
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00008402001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.2e-313587254
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                         prlrWtp+LH++Fv+av+ LGG+++AtPk +l++m+vkgLt++hvkSHLQ++R
  GSBRNA2T00008402001 35 PRLRWTPDLHRCFVNAVDMLGGQHRATPKLVLKMMDVKGLTISHVKSHLQMHR 87
                         8***************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1193191IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-293188IPR009057Homeodomain-like
SuperFamilySSF466893.76E-143587IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-223587IPR006447Myb domain, plants
PfamPF002493.8E-83687IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGKAAGRNGN ENYNGVGFNG QRGGGVRPYV RSPVPRLRWT PDLHRCFVNA VDMLGGQHRA  60
TPKLVLKMMD VKGLTISHVK SHLQMHRGSK LTLGKPEESS SSSIRRRQDT EEDNLHDNLS  120
LHTRNDCLLG FHSFPLSSHS SLRGGRKKEQ TSESSGDDDA DFLHTMNMKK TKETTMFRSH  180
HFHKKTEKEK NTWQEHEEEA DLSLSLSLNH HHWRSNGSSV SETSEAVSTC SAPFIFKDCL  240
GSSPKIDLNL NLSISLLGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013693582.10.0PREDICTED: putative Myb family transcription factor At1g14600
SwissprotQ700D94e-77MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A078JZ200.0A0A078JZ20_BRANA; BnaCnng70380D protein
STRINGBra026618.1-P1e-174(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-68G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]